PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr004500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 168aa    MW: 19092 Da    PI: 9.5735
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr004500.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.83e-51141381128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelv +yL++kv + +l++ ++i+evd++k++PwdLp       +e yfFs+r+ ky++g+r+nrat sgyWkatg dk++++  +g
  Pbr004500.1  14 LPPGFRFHPTDEELVLQYLRRKVYSCPLPA-SIIPEVDVCKADPWDLPGD---CAQERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIVTCrGG 107
                  79****************************.89***************44...35799*********************************9876589 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kktLvfy+g+ p+g++tdW+mheyrl
  Pbr004500.1 108 QVVGIKKTLVFYRGKPPHGTRTDWIMHEYRL 138
                  99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-5710144IPR003441NAC domain
PROSITE profilePS5100553.80514163IPR003441NAC domain
PfamPF023653.8E-2715138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MERINFVKNG VLRLPPGFRF HPTDEELVLQ YLRRKVYSCP LPASIIPEVD VCKADPWDLP  60
GDCAQERYFF STREAKYPNG NRSNRATGSG YWKATGLDKQ IVTCRGGQVV GIKKTLVFYR  120
GKPPHGTRTD WIMHEYRLVL PENPASVAPP EKNATQVSFL FYLVLFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-491214118148NAC domain-containing protein 19
3swm_B4e-491214118148NAC domain-containing protein 19
3swm_C4e-491214118148NAC domain-containing protein 19
3swm_D4e-491214118148NAC domain-containing protein 19
3swp_A4e-491214118148NAC domain-containing protein 19
3swp_B4e-491214118148NAC domain-containing protein 19
3swp_C4e-491214118148NAC domain-containing protein 19
3swp_D4e-491214118148NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349483.11e-124PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY939e-87NAC83_ARATH; NAC domain-containing protein 83
TrEMBLD9ZJA01e-113D9ZJA0_MALDO; NAC domain class transcription factor
STRINGPOPTR_0001s13380.14e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.15e-88NAC domain containing protein 83